SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5A2W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5A2W4
Domain Number 1 Region: 30-76
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000000183
Family Cysteine-rich DNA binding domain, (DM domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5A2W4
Sequence length 125
Comment (tr|A0A0N5A2W4|A0A0N5A2W4_PARTI) Uncharacterized protein {ECO:0000313|WBParaSite:PTRK_0001597500.1} KW=Complete proteome; Reference proteome OX=131310 OS=Parastrongyloides trichosuri (Possum-specific nematode worm). GN= OC=Parastrongyloides.
Sequence
MMRFEPFNAFSALNVAAVSGFNNESLKAGTQKRVYYCQRCLNHDRLEPRKNHKCECAYAN
CSCPKCILVEKRRVLNTQLHELEDVSESQITVESIKKDVEDIDNENGDDNGSSSEHSAGG
RIKGG
Download sequence
Identical sequences A0A0N5A2W4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]