SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5A442 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5A442
Domain Number 1 Region: 242-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-29
Family cAMP-binding domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 118-236
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-29
Family cAMP-binding domain 0.0000133
Further Details:      
 
Domain Number 3 Region: 14-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.09e-16
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5A442
Sequence length 375
Comment (tr|A0A0N5A442|A0A0N5A442_PARTI) Uncharacterized protein {ECO:0000313|WBParaSite:PTRK_0001639300.1} KW=Complete proteome; Reference proteome OX=131310 OS=Parastrongyloides trichosuri (Possum-specific nematode worm). GN= OC=Parastrongyloides.
Sequence
MSSGGDNCSEEAQLAQCQLYVQRHNIQQLVKEAIVSLCIHKPENPILFLKEHFDKLNEHR
SQSDTHEHENIEDDDTMDEPPKLPQGNRRRLGVSAEVPDENEAANYKRVVIPKDPETEKS
LRAAMCKNVLFAHLDADEEKAIFDAMFPVEKKKGEKIIEQGEEGDNFYVIDSGEVDVYVN
NEFMISIKEGGSFGELALIYGTPRAATVIAKSDTVKLFAIDRLTYRQILMGSTMRKRKLY
DEFLSKVQILADLDKWERANVADALERCDFEKGTHVVEQGQPGDEFYIIVEGEASVLQKR
ADDAPYETVGHLTSSDYFGEIALLLDRPRAATVVAESPLKCVKLDRARFERVMGPVREIL
KRDVSNYNSYVKLMT
Download sequence
Identical sequences A0A0N5A442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]