SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5BMK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5BMK6
Domain Number 1 Region: 19-67
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000907
Family Cystatins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N5BMK6
Sequence length 121
Comment (tr|A0A0N5BMK6|A0A0N5BMK6_STREA) Uncharacterized protein {ECO:0000313|WBParaSite:SPAL_0000714425.1} KW=Complete proteome; Reference proteome OX=174720 OS=Strongyloides papillosus (Intestinal threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MKYFFLVHILFFALFIVILSQTIQYGNWKNLNPNSPIVRKWANEGVSLYGAERNKTFILV
RVLRAQSRNGFSAPNITVKRHRVYCTARNAMCPRLGGCKRSLRTIIVNYLNGTRTVNVRL
I
Download sequence
Identical sequences A0A0N5BMK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]