SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5CCG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5CCG8
Domain Number 1 Region: 93-112,154-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000255
Family Motor proteins 0.016
Further Details:      
 
Domain Number 2 Region: 7-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N5CCG8
Sequence length 224
Comment (tr|A0A0N5CCG8|A0A0N5CCG8_STREA) Uncharacterized protein {ECO:0000313|WBParaSite:SPAL_0001557700.1} KW=Complete proteome; Reference proteome OX=174720 OS=Strongyloides papillosus (Intestinal threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MSEQMSEKYKIPEALRPLLEALARETIRAQPADVISFGKLFFDILSLHQKDSDKSVISDN
ISYDMFRMDLQQRYKNMTMKENIMRSASPEDIAATKIQAVFRGHQVRMHPEKYGIDNELV
RRRSSDKFPTLDFKKDQKRHSIGGYSLEHSQTPEDRAATKIQAEFRGYLARKNVQAMREQ
NDNAATKIQAHVRGFLTRKRLGKEGLISPSRSHSSLQSHKSEEN
Download sequence
Identical sequences A0A0N5CCG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]