SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5CQC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5CQC2
Domain Number 1 Region: 145-192
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.00000000000000196
Family Cysteine-rich DNA binding domain, (DM domain) 0.00067
Further Details:      
 
Domain Number 2 Region: 12-58
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000000209
Family Cysteine-rich DNA binding domain, (DM domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5CQC2
Sequence length 310
Comment (tr|A0A0N5CQC2|A0A0N5CQC2_THECL) Uncharacterized protein {ECO:0000313|WBParaSite:TCLT_0000242201-mRNA-1} KW=Complete proteome; Reference proteome OX=103827 OS=Thelazia callipaeda (Oriental eyeworm) (Parasitic nematode). GN= OC=Spiruromorpha; Thelazioidea; Thelaziidae; Thelazia.
Sequence
MNIEEILPELFGEKRVYYCQRCLNHGLEVRRKNHKLECVYRFCTCNDCQMVDKRRELNSR
LLQIENTSSPTPPPPSSSSPSSVSLSSLSSSSSSSFSQILPSNGTSTGTAQRFPNIRLLP
TVSDQTISSISIKGKGRLRNFVIFLERRPNCQRCAQHSVLARLKGHKRCCPFRDCPCAKC
QVVQERQKLMADQIKLRRRQKKQKILDTLHDNSNLRNHKNYSDQIVLLNGCLKCAQQALA
YQQLLTFIDSKATLEPSIISAILAACPHNNNNNNNNNNNNNIVNNSIINNNNHITNTINT
NDNNGYGKNE
Download sequence
Identical sequences A0A0N5CQC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]