SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N7F1M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7F1M9
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 3.4e-26
Family (Pro)aerolysin, pore-forming lobe 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N7F1M9
Sequence length 74
Comment (tr|A0A0N7F1M9|A0A0N7F1M9_AERHY) Cytotoxic enterotoxin {ECO:0000313|EMBL:ALG03200.1} OX=644 OS=Aeromonas hydrophila. GN=act OC=Aeromonadaceae; Aeromonas.
Sequence
ELYKADISYPYEFKADVSYDHARCGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSI
RYQWDKRYIPGEGK
Download sequence
Identical sequences A0A0N7F1M9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]