SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N7HVM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0N7HVM4
Domain Number - Region: 12-123
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0523
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N7HVM4
Sequence length 137
Comment (tr|A0A0N7HVM4|A0A0N7HVM4_9PHYC) Uncharacterized protein {ECO:0000313|EMBL:ALI95605.1} KW=Complete proteome OX=1663208 OS=Ostreococcus lucimarinus virus 2. GN=OlV2_242 OC=unclassified Prasinovirus.
Sequence
MVMSKNDILLTSINNFYDNEKNKSTLLTILDKTSGISLRNLEWFITNYAKKNHTSYQTGD
GKLFTVHCAYKSSLNGYSKQLFDPFCRSQKFPYTIPGTSHEIQTTLAQLNFIKWCIKNNI
IDYIAENKEKLFSKQLT
Download sequence
Identical sequences A0A0N7HVM4 E4WM85 I3UJX0 I3UKL6 M4QQI6
gi|314055304|ref|YP_004063642.1| gi|472341158|ref|YP_007674677.1| YP_004063642.1.10905 YP_007674677.1.88194 YP_009172733.1.30483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]