SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N7L7R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7L7R2
Domain Number 1 Region: 13-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 
Domain Number 2 Region: 62-121
Classification Level Classification E-value
Superfamily EF-hand 0.0000691
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N7L7R2
Sequence length 135
Comment (tr|A0A0N7L7R2|A0A0N7L7R2_9STRA) Ef-hand calcium-binding domain-containing protein 10-like {ECO:0000313|EMBL:CEG47787.1} KW=Complete proteome; Reference proteome OX=4781 OS=Plasmopara halstedii. GN= OC=Plasmopara.
Sequence
MSSDVNMKDPKVQAELYMASHGIKELFHRLGALLLYHRPSNPREFLFQSLKKMQDAKQTQ
RHIPFFDDKDLKAMFLAFDIKEQGYITLEQYDQALLNFGIETPTICLPESATMIGQALFI
RSVTQELKHASASFM
Download sequence
Identical sequences A0A0N7L7R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]