SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8A118 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8A118
Domain Number 1 Region: 42-158
Classification Level Classification E-value
Superfamily ISP domain 3.64e-31
Family Rieske iron-sulfur protein (ISP) 0.00000861
Further Details:      
 
Domain Number 2 Region: 11-54
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00000000000262
Family ISP transmembrane anchor 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N8A118
Sequence length 169
Comment (tr|A0A0N8A118|A0A0N8A118_9CRUS) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
SLSLTSIFAKAKTSASRQGFSYLIVGSGAVGGAYAAKSVVGEFVSSMSASADVLALAKIE
VKLNDIPEGKNVTFKWRGKPLFIRHRTAAEIDAESNVDLSSLRDPQLDSDRAQRPEWLVL
LGVCTHLGCVPIANSGDFGGYYCPCHGSHYDSSGRIRKVQRRTLLVKSF
Download sequence
Identical sequences A0A0N8A118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]