SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8B3B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8B3B1
Domain Number 1 Region: 83-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000776
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 148-194
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 3 Region: 204-250
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000263
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N8B3B1
Sequence length 250
Comment (tr|A0A0N8B3B1|A0A0N8B3B1_9CRUS) Putative Notch {ECO:0000313|EMBL:JAK34754.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSVTVGNQNLFAMSFPYVFPSVPHTGSYCNVQIVNSCLPCNYKYFNLQNLKMLQVALQNF
FSTVLVLIALFVLTSNQLVVFGASIDQRDVCICTLQYDPVCGTDGKTYGNACALHCQIKE
NTGVSLGKAYDGECKQANERGKRGAAECGCTFLYAPVCGTDGKTYDNENCMEVEITKCGT
VLDSAIKKAYDGECRQVSKPSEEVCACPLNYAPVCGTDGNTYANVDCFKNEITKCGTIKS
SVTVARDGAC
Download sequence
Identical sequences A0A0N8B3B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]