SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8EGS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8EGS7
Domain Number 1 Region: 473-515
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000251
Family VWC domain 0.037
Further Details:      
 
Domain Number 2 Region: 113-191
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000785
Family Fibronectin type I module 0.08
Further Details:      
 
Domain Number 3 Region: 235-315
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000544
Family VWC domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N8EGS7
Sequence length 928
Comment (tr|A0A0N8EGS7|A0A0N8EGS7_9CRUS) BMP-binding endothelial regulator protein {ECO:0000313|EMBL:JAN66485.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MASSCGVVKLSIATARFSVCFISAIVLVTSLIGGGGFISRHPNCADAIQIASLTATNQNC
TNEGQTVVVKIVEEFIPCMTCMCKDGHVQCKKEICPSTGNCYVVLQQNKSAAKCCQVCKG
CYYRGVHYQSGSQWNDPDDPCQTMTCQGGVVTVSRQTCRWNEEDASTADGHCQHLLPARR
GECCPRCKGCQWRQARTMTCQGGVVTVSRQTCRWNEEDAATADGHCQHLLPARPGECCPR
CKGCQWRQARNGRNVTMAEGGPAASPDPLTEPCTQCQCLPGGSMMCTRQTCPVLPCPANK
ALLQPGACCPVCQGVRKEVQPAMAAPAVCQIGKKQFELGAKFRPDPCTNCTCQPNSTTVC
LRDNSRRLGGSSSSSSCPNVHPATITVAPPLLASWPSDAVASKSATTQPSAMAVVASFQR
QQEAAAAAASSSSSSSSILSTHGKGSQPQQQQQQQQQQPAMQTPTALPASRPLTCAYRGV
TYQDGAGWSLDPCTQCSCSQGEVRCAVQQCPVYRPKDHHRRKMKSSDSDSSSSSSSSSSS
SSSGSGNNVQSPLQAANAGQPCPPGRHPVKEAGQCCPKCVEDDAVCTVFGDPHYRTFDGR
VFNFQGACKYLLTSDCRNDTFSVRVTNDARSSRSFSWTKTVTLTIEDLKVTLGQNMKVKV
NHKRVSLPFVSLGVLSVVQEGYSVVVRTNLGVKLLWDGESFLEVTVPPAFKRRLCGLCGN
FNGRRRDDLRMRSGQLATSVEQFGASWKVGGPKSCSSTSTSTSSSAGSSQQQRPPPSSSS
SSSADRLSQRRFQQHHPNQLASSSSATASSSSAAVAGKKTITAAAPDEPLCQRQWHIRIR
AVRECSVLKAATFAQCHAQVSPVRYFKSCLLDMCECPSGKQCYCEALTAYARECARHGVT
QIDPKWREVTSCTGHHHTGGSTRLHPST
Download sequence
Identical sequences A0A0N8EGS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]