SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8H3J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8H3J8
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily YdhG-like 2.09e-20
Family YdhG-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N8H3J8
Sequence length 196
Comment (tr|A0A0N8H3J8|A0A0N8H3J8_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KPM30772.1} KW=Complete proteome; Reference proteome OX=1300341 OS=Croceitalea dokdonensis DOKDO 023. GN=I595_3269 OC=Flavobacteriaceae; Croceitalea.
Sequence
MSTLEKVTSYYEKEHPFKEGITILRKLAKETDLKEDYKWQFPTYTLHGKNVFSICRFKKH
FGVWFFKGVLLNDRDNVLVNAQKGKTKEMRHWKFKSNQEINTALVREYFMEAILNQQQGK
TTVAKIPEAIVVPQLLAAALRQDPSLQKAFYQLTTSKQRAYALYIHDAKRENTKLNRLQK
IIPMIKKGLGLSDKYR
Download sequence
Identical sequences A0A0N8H3J8
WP_054560243.1.97692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]