SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8K074 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8K074
Domain Number 1 Region: 241-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-32
Family cAMP-binding domain 0.000000565
Further Details:      
 
Domain Number 2 Region: 112-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-31
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 3 Region: 10-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.57e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N8K074
Sequence length 374
Comment (tr|A0A0N8K074|A0A0N8K074_9TELE) cAMP-dependent protein kinase type I-alpha regulatory subunit-like isoform X1 {ECO:0000313|RefSeq:XP_018612537.1, ECO:0000313|RefSeq:XP_018612545.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_109758 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MASTSEEERSLRECEQYVQRHGIQQLLKDCIVQLCTARPERPVAFLREYFQRLEKEEAKQ
IINQQKSNSRSDSRDDEISPPVNPGVKARRGAISAEVYTEEDAASYVRKVIPKDYKTMAA
LAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQGEMDVYVD
SEWVTGIREGGSFGELALIYGTPRAATVQAKTNAKLWGIDRDSYRRILMGSTLRKRKMYE
EFLSKVSILESLDKWERLTVADALETVQFEDGQKIVIQGEPGDKFFIILEGTAAVLQRRS
EEEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILK
RNIQQYNSFVSLSV
Download sequence
Identical sequences A0A0N8K074
XP_018612537.1.37976 XP_018612545.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]