SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8RIK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8RIK4
Domain Number 1 Region: 78-151
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000022
Family PA0094-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N8RIK4
Sequence length 193
Comment (tr|A0A0N8RIK4|A0A0N8RIK4_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KPX31839.1} KW=Complete proteome OX=251653 OS=Pseudomonas coronafaciens pv. garcae. GN=ALO77_00078 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas coronafaciens.
Sequence
MARPSLYDRISAKRIADEEAARKAALEAPVVEAVPEPEPEPVTPLQDVPTSFNFSGFTLA
FPESMLFREIQATVEYKGETLTLSVKRKDVMQGETLEALFEHSVQAFREHDPELRIIRRR
DCTLAGCAAKALDFHFKVGSEEHHARLVGALVPLAGKDVLQWLEISCLIDPTKPDLSLWM
ADFDSMLSGLAAH
Download sequence
Identical sequences A0A0M0VAJ5 A0A0N0VXF1 A0A0N8RIK4 A0A0N8T946 A0A0P9IXY5 A0A0Q0HJW3
WP_024671251.1.101556 WP_024671251.1.25774 WP_024671251.1.34239 WP_024671251.1.53177 WP_024671251.1.60753 WP_024671251.1.72387 WP_024671251.1.72776 WP_024671251.1.76978 WP_024671251.1.82790 WP_024671251.1.87053 WP_024671251.1.92625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]