SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8SD26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0N8SD26
Domain Number - Region: 80-104
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.017
Family Rabenosyn-5 Rab-binding domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N8SD26
Sequence length 138
Comment (tr|A0A0N8SD26|A0A0N8SD26_PSESH) Uncharacterized protein {ECO:0000313|EMBL:KPY14416.1} KW=Complete proteome OX=319 OS=phaseolicola). GN=ALO55_03360 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MHWMILAAALALSTTSQAASIYKWVDAQGVTHFDAQPPTGQQVQEINVQTPPPASAPSTP
ADDGAAQQRVIDQKVKSQVKAQEAKRAENCETLRTNLAQLQNNPRVREQVGGESRRLTEE
NRKTRTEETEKAISEFCR
Download sequence
Identical sequences A0A0N0F4V6 A0A0N0WQA0 A0A0N8SD26 A0A0P9S3I2 A0A1E3XPV2 Q48N69
264730.PSPPH_0871 gi|71737335|ref|YP_273152.1| WP_004663736.1.101587 WP_004663736.1.10739 WP_004663736.1.12791 WP_004663736.1.14608 WP_004663736.1.20304 WP_004663736.1.27185 WP_004663736.1.28195 WP_004663736.1.31015 WP_004663736.1.37820 WP_004663736.1.61736 WP_004663736.1.65103 WP_004663736.1.67845 WP_004663736.1.70455 WP_004663736.1.74374 WP_004663736.1.86037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]