SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8TJG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0N8TJG9
Domain Number - Region: 43-137
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00366
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N8TJG9
Sequence length 269
Comment (tr|A0A0N8TJG9|A0A0N8TJG9_PSESX) Uncharacterized protein {ECO:0000313|EMBL:KPZ30361.1} KW=Complete proteome OX=103985 OS=Pseudomonas syringae pv. theae. GN=AN901_202345 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MEAEQVWKLWRHVLRDERLQAQLFSATDATHWLSGFSESESEILSVYAQQFDRVKWFVEN
YQFRLVNSFLNALETGAPLSLRALLHINVDLNAQSKAFLRDRQWRDYGPQVYTYCDDVLG
FLAEADELQGYPEILDLMRLERESIRLYRGLVDPESLPADNRYHRTSMARLYETRFALSG
WLRQKDQLGLTRLPESIEQVLIYLPTLQARHKFTLINAQAARLYNCLEQPQSAAGLFMLI
NSDSASVPGSADLALLDRLEQLNAIRKPL
Download sequence
Identical sequences A0A0N8TJG9
WP_019331905.1.18673 WP_019331905.1.25462 WP_019331905.1.28366 WP_019331905.1.50828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]