SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N9MT16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N9MT16
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily MbtH-like 8.37e-33
Family MbtH-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N9MT16
Sequence length 76
Comment (tr|A0A0N9MT16|A0A0N9MT16_9ACTN) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:ALG85665.1} KW=Complete proteome; Reference proteome OX=1136941 OS=Gordonia phthalatica. GN=ACH46_15755 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MTNPFDDENGRFYVLVNHENQHSLWPTFADIPAGWNKVFGEDSREACLKYVEENWTDLRP
QSLIDAMEADKAAREG
Download sequence
Identical sequences A0A0N9MT16
WP_062393755.1.63082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]