SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N9NK55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N9NK55
Domain Number 1 Region: 41-119
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.15e-19
Family Periplasmic chaperone C-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N9NK55
Sequence length 125
Comment (tr|A0A0N9NK55|A0A0N9NK55_PECCA) Putative fimbrial chaperone protein ElfD {ECO:0000313|EMBL:ALG88658.1} OX=554 OS=Pectobacterium carotovorum (Erwinia carotovora). GN= OC=Pectobacteriaceae; Pectobacterium.
Sequence
MPAGKKQAAIPSPVLGGSIQVATATVVKLFYRPSGLPFPHQQAMGMLEFSGASQGLKVTN
PTPYYITLSSLRVGREQVSLSAATGNTLIAPFGSQVYPRAPHQGKVEWKAINDYGGAEVF
YGSVH
Download sequence
Identical sequences A0A0N9NK55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]