SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N9RU04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0N9RU04
Domain Number - Region: 9-72
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.051
Family Pseudo ankyrin repeat 0.02
Further Details:      
 
Domain Number - Region: 55-106
Classification Level Classification E-value
Superfamily Prefoldin 0.0915
Family Prefoldin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N9RU04
Sequence length 117
Comment (tr|A0A0N9RU04|A0A0N9RU04_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:ALH46635.1} KW=Complete proteome; Reference proteome OX=1732063 OS=Staphylococcus phage SPbeta-like. GN=SPbetalike_00088 OC=Spbetavirus; unclassified Spbetalikevirus.
Sequence
MKNLELFYEAVEKLMTEYKNDYPINEKWNLSRVHINEYKSKVTLDFTTKCELPVSIVMTN
GIVSKLMKKNINFNTYYLDEIKKQLEERNNEMDHIQEDKRRRTNQIDVFIKKFLKGN
Download sequence
Identical sequences A0A0E1AJZ4 A0A0N9RU04 A0A0Z4I4G0 A0A2G8HL51 A0A2K3Z7J8 A0A2K4DHS5
gi|387143639|ref|YP_005732033.1| gi|554644860|ref|YP_008716651.1| WP_000792728.1.100433 WP_000792728.1.100800 WP_000792728.1.10109 WP_000792728.1.101292 WP_000792728.1.101732 WP_000792728.1.10486 WP_000792728.1.11097 WP_000792728.1.12195 WP_000792728.1.12226 WP_000792728.1.12254 WP_000792728.1.1311 WP_000792728.1.1355 WP_000792728.1.13713 WP_000792728.1.13726 WP_000792728.1.1487 WP_000792728.1.15050 WP_000792728.1.17245 WP_000792728.1.17520 WP_000792728.1.17536 WP_000792728.1.18538 WP_000792728.1.18627 WP_000792728.1.19807 WP_000792728.1.19853 WP_000792728.1.20471 WP_000792728.1.21081 WP_000792728.1.2143 WP_000792728.1.22351 WP_000792728.1.2266 WP_000792728.1.23489 WP_000792728.1.2357 WP_000792728.1.2398 WP_000792728.1.23999 WP_000792728.1.26887 WP_000792728.1.27020 WP_000792728.1.27666 WP_000792728.1.28477 WP_000792728.1.30044 WP_000792728.1.30154 WP_000792728.1.30590 WP_000792728.1.30779 WP_000792728.1.31449 WP_000792728.1.32007 WP_000792728.1.32454 WP_000792728.1.33089 WP_000792728.1.33372 WP_000792728.1.33701 WP_000792728.1.34705 WP_000792728.1.36104 WP_000792728.1.36814 WP_000792728.1.3735 WP_000792728.1.37506 WP_000792728.1.37572 WP_000792728.1.37755 WP_000792728.1.38090 WP_000792728.1.39642 WP_000792728.1.40535 WP_000792728.1.41570 WP_000792728.1.4202 WP_000792728.1.44120 WP_000792728.1.44178 WP_000792728.1.45766 WP_000792728.1.46159 WP_000792728.1.46800 WP_000792728.1.48683 WP_000792728.1.4924 WP_000792728.1.49362 WP_000792728.1.51168 WP_000792728.1.51741 WP_000792728.1.52629 WP_000792728.1.54290 WP_000792728.1.54929 WP_000792728.1.55309 WP_000792728.1.57912 WP_000792728.1.59612 WP_000792728.1.60263 WP_000792728.1.604 WP_000792728.1.60471 WP_000792728.1.61134 WP_000792728.1.61413 WP_000792728.1.62781 WP_000792728.1.63714 WP_000792728.1.64628 WP_000792728.1.64636 WP_000792728.1.64643 WP_000792728.1.64998 WP_000792728.1.65193 WP_000792728.1.65731 WP_000792728.1.67320 WP_000792728.1.67846 WP_000792728.1.69277 WP_000792728.1.69584 WP_000792728.1.69585 WP_000792728.1.70059 WP_000792728.1.70664 WP_000792728.1.71721 WP_000792728.1.72059 WP_000792728.1.72067 WP_000792728.1.72229 WP_000792728.1.7254 WP_000792728.1.73002 WP_000792728.1.7360 WP_000792728.1.75383 WP_000792728.1.75800 WP_000792728.1.76151 WP_000792728.1.76674 WP_000792728.1.78335 WP_000792728.1.79087 WP_000792728.1.79581 WP_000792728.1.80210 WP_000792728.1.80285 WP_000792728.1.80313 WP_000792728.1.81188 WP_000792728.1.81290 WP_000792728.1.81818 WP_000792728.1.81837 WP_000792728.1.82021 WP_000792728.1.8237 WP_000792728.1.82878 WP_000792728.1.84232 WP_000792728.1.85118 WP_000792728.1.85768 WP_000792728.1.86391 WP_000792728.1.86779 WP_000792728.1.89239 WP_000792728.1.89842 WP_000792728.1.910 WP_000792728.1.91141 WP_000792728.1.92296 WP_000792728.1.92977 WP_000792728.1.93567 WP_000792728.1.94324 WP_000792728.1.94358 WP_000792728.1.95367 WP_000792728.1.95589 WP_000792728.1.96688 WP_000792728.1.97295 WP_000792728.1.97999 YP_009226764.1.100275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]