SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N9XBM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N9XBM5
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily BH3703-like 1.14e-17
Family BH3703-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N9XBM5
Sequence length 115
Comment (tr|A0A0N9XBM5|A0A0N9XBM5_PSEFL) Uncharacterized protein {ECO:0000313|EMBL:ALI08792.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=AO356_18845 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSEQGLYQKVGQLLLDAGPSEAQKIVVRARLFAEGDGGSYEFDYFDKTNRSSWFDPDSRA
VGDLTELLVELRRYYVENGLCQNGKAWSSCAVTLDVEKMKISIDYNYDDKVLFAE
Download sequence
Identical sequences A0A0N9XBM5
WP_060741024.1.35613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]