SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0CYJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0CYJ7
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.0000000314
Family PG0164-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P0CYJ7
Sequence length 171
Comment (tr|A0A0P0CYJ7|A0A0P0CYJ7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ALI99588.1} KW=Complete proteome; Reference proteome OX=512763 OS=Rufibacter tibetensis. GN=DC20_12145 OC=Rufibacter.
Sequence
MTSIQFNTHIGKLEYLMGTHYIEVPQEIVQQLGGKFKVRLLCTVNNTLTYQCGIVALGQG
RGYITLTKQRLMQLGLQEGNSVSVSLEKDDSPYGTVVPEELSELFLQDDAGKARFDQLKP
GMQRYIIQHVGAVKSSQLRIDRSITLIENLKRLKPGQETFREILGMDKREL
Download sequence
Identical sequences A0A0P0CYJ7
WP_062544074.1.29729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]