SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0N5G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0N5G4
Domain Number 1 Region: 57-210
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 7.45e-25
Family AF0587 domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P0N5G4
Sequence length 223
Comment (tr|A0A0P0N5G4|A0A0P0N5G4_9CREN) Uncharacterized protein {ECO:0000313|EMBL:ALL01590.1} KW=Complete proteome; Reference proteome OX=1273541 OS=Pyrodictium delaneyi. GN=Pdsh_05695 OC=Pyrodictiaceae; Pyrodictium.
Sequence
MPRHQLLENALLQSQQKPKTRFSIRKDEAGRLMPRHYNGVDPDLVGEKAFNHPSVRGWWS
WLKERYQPENNIALITPCSSVKPYTRSPTSRKIRGLLRRLGLWDTIADKPRGIEWLYFSD
LLILVPYERAEEYPACCYEVPPDIVLENTELSRVVTTLLAESMEALLGRGVNQVIVFLPR
KHLRLWEEARSKAAKWPREHRVTYTLFSTKSLGDAIINVIETD
Download sequence
Identical sequences A0A0P0N5G4
WP_055410884.1.33427 WP_055410884.1.68244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]