SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0QJY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0QJY9
Domain Number 1 Region: 80-206
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.59e-45
Family PH0987 C-terminal domain-like 0.0000065
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000523
Family PH0987 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P0QJY9
Sequence length 210
Comment (tr|A0A0P0QJY9|A0A0P0QJY9_SERMA) Uncharacterized protein {ECO:0000313|EMBL:ALL40236.2} KW=Complete proteome OX=615 OS=Serratia marcescens. GN=AR325_08385 OC=Yersiniaceae; Serratia.
Sequence
MGERAVVLELSPPVTLPSQQRIWALAEKLNHHPDVREVVPGMNNLTLLLHTPQADAEAML
ALLQQGWESKERLTPESRQVDIPVIYGGEQGPDLDEVARHTGMTPQQVVECHAAAAYVVY
FLGFQPGFSYLGGMPEQLATPRRAEPRLAVAAGSVGIGGGQTGIYPLATPGGWQLIGRTP
LALFNPHEMPPTLLRPGDSVRFVPQKEGVC
Download sequence
Identical sequences A0A0P0QJY9
WP_076606817.1.25326 WP_076606817.1.58287 WP_076606817.1.78348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]