SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0X2H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0X2H5
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.14e-18
Family Skp1 dimerisation domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P0X2H5
Sequence length 54
Comment (tr|A0A0P0X2H5|A0A0P0X2H5_ORYSJ) Os07g0144900 protein {ECO:0000313|EMBL:BAT00039.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_070144900 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
LNIKSLLDMTCQRVADMMSGKTPEQMRETFSIENDFTPEEEAAIRQENAWAFDD
Download sequence
Identical sequences A0A0P0X2H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]