SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0XDT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0XDT1
Domain Number 1 Region: 71-184
Classification Level Classification E-value
Superfamily TPR-like 1.47e-36
Family Tetratricopeptide repeat (TPR) 0.00059
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000157
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P0XDT1
Sequence length 197
Comment (tr|A0A0P0XDT1|A0A0P0XDT1_ORYSJ) Os08g0233400 protein {ECO:0000313|EMBL:BAT04441.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_080233400 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
QPLFQAVNVSSVECVKLLVEAGADVNSDCISTAALDSAMGNDGSTECLNFLMEAGANYGG
PNDDQHVNKKKIEELKTSGNKAVDREDYISASAFYTKAMDLDPNDATLFSNRSLCWLCMG
DGKKAFLDALECREMRPDWPKACYRLGAALMTLKDFESACDALFDGFKLDPDNAEIERAL
REAMESLKISSKGTKAT
Download sequence
Identical sequences A0A0P0XDT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]