SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0YP35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0YP35
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.85e-48
Family RecA protein-like (ATPase-domain) 0.0000000681
Further Details:      
 
Domain Number 2 Region: 184-246
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000641
Family Intein (protein splicing domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P0YP35
Sequence length 260
Comment (tr|A0A0P0YP35|A0A0P0YP35_9ACTN) Recombinase A {ECO:0000256|RuleBase:RU000526} OX=37483 OS=Sphaerimonospora mesophila. GN=recA OC=Sphaerimonospora.
Sequence
FGKGSVMRLGDDTRPAIEVIPTGSISLDVALGIGGFPRGRIVEVYGPESSGKTTVALHAV
ANAQRGGGIAAFIDAEHALDPEYAKKLGVDVDALLVSQPDTGEQALEIADMLIRSGAIDI
IVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKVAGALNQTRTTAVFINQLREKIG
VMFGCMSYGTKVTLADGTQEKIGKIVNQRMNVEVLSYDPESDRVVPRPITNWFENGNAER
FLQFTVAKSGGNGRAQFAAT
Download sequence
Identical sequences A0A0P0YP35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]