SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P1A9E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P1A9E9
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000641
Family AN1-like Zinc finger 0.0036
Further Details:      
 
Domain Number 2 Region: 52-65,95-149
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000549
Family AN1-like Zinc finger 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P1A9E9
Sequence length 296
Comment (tr|A0A0P1A9E9|A0A0P1A9E9_9STRA) Zinc finger an1 and c2h2 domain-containing stress-associated protein 16-like {ECO:0000313|EMBL:CEG37350.1} KW=Complete proteome; Reference proteome OX=4781 OS=Plasmopara halstedii. GN= OC=Plasmopara.
Sequence
MDVGAHCSMPACHQQDFLPFKCDCCSGIFCLDHRSYDTHECSKAGSRDRRVVQCPVCKQM
IHWTAEQEVNAVWEEHVRVGQCTREKFKQQQLRLQNKPKKKRCAADGCRESLLVSNQFHC
KKCAHDVCLKHRFEPDHDCERKRKNQRQQWLGGLKTSSTSAAIPKQLSNFQKNAQTAASS
VVTGTKTAVSSIVQKVTTTSEECPMCQQKFAYVSQLIAHVNHAHPETSNIRGTTNITTQT
AASSVPDHSEVCPQCHAIFPTLIALIQHAETAHTGAVVSGRDGSTGGGDRDKCSVM
Download sequence
Identical sequences A0A0P1A9E9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]