SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P1IPJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P1IPJ8
Domain Number 1 Region: 12-65
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.0000173
Family PG0164-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P1IPJ8
Sequence length 141
Comment (tr|A0A0P1IPJ8|A0A0P1IPJ8_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:CUK25546.1} KW=Complete proteome; Reference proteome OX=1715691 OS=Thalassobius activus. GN=TA5114_01347 OC=Rhodobacteraceae; Thalassobius.
Sequence
MPPRFEAELPFKTYPRLRVEGEIADVPVRGAWMPVGDGRRYFIVSPDIKANTGLDVGDVV
EMRFRVDDQDYVDVPGALQAALNTDDAALAQWDKLTAGKKRMFTNHVFSAKTAPTEQRRV
DEAVFAITEGITLRDLQKRKG
Download sequence
Identical sequences A0A0P1IPJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]