SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4VJF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0P4VJF0
Domain Number - Region: 151-205
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000304
Family SNARE fusion complex 0.0077
Further Details:      
 
Domain Number - Region: 79-151
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0275
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P4VJF0
Sequence length 234
Comment (tr|A0A0P4VJF0|A0A0P4VJF0_9HEMI) Golgi SNAP receptor complex member 1 {ECO:0000256|PIRNR:PIRNR027109} OX=72488 OS=Rhodnius neglectus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
MSSTSYEDLRKQARRLENEIDLNLISFCKLCAGKVENDKGEGVTEPLLASERGRDVEAAS
LEIEGLLLQLKAINEQMSEMPINSTGFAQHTLQRHREILADYSSEFNKTLDNYRARKNKE
DLLRNVRTDMNYKPSTSSGLNRRMDLYLKENEHIRSSSRLIDDQISIAVETREELMSQRL
TMKKLQTRLHDVSSRLPIVNSLLHRINFRRRRDSFIVGLVVFICTILLLTALFR
Download sequence
Identical sequences A0A0P4VJF0 R4G830
RPRC007805-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]