SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4VL77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4VL77
Domain Number 1 Region: 566-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 408-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 604-640
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 272-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 528-563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 446-486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 642-669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 8 Region: 490-529
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 9 Region: 165-252
Classification Level Classification E-value
Superfamily SEA domain 0.0000732
Family SEA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P4VL77
Sequence length 669
Comment (tr|A0A0P4VL77|A0A0P4VL77_9HEMI) Putative basement membrane-specific heparan sulfate proteoglycan core protein isoform x13 {ECO:0000313|EMBL:JAI52382.1} OX=72488 OS=Rhodnius neglectus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
MREPLCLLGICLLLVLSHHRTLAFNDDNDLTFEELSPSWEGQKIVEKPTELSFHHRIYSR
VQDVVHRVKRDWFDWFAKTTTTAPESQTSATEPTTVSTEAVHSSSTTPSARETRSTVVDG
DDEDNLDLGSGAVSSSGSVTTDVLPSPDVHPVKHAVFRLSMDLEELYNHDLSNRKSEEFQ
RLSQKLTEAIDKEYEALPGTQRSRLIGIKEIKGESVWVRAHVDLVSTGFDDEHRIQEVIE
NKIFTSRRIGQLVVQNLNFQRFGEVDDPSMELPICSHSQMQCDDGVTCLEHDLRCNSRED
CPLGEDESGCPSTVPVEHHVERDNGVGTEHNLLPIFPPSHETTRCRADDHVRCADGSVVI
CEDQKCDGVRHCPAGDDEENCPEEETEHPSEEPPTSATTATTSTTTTPPHTHCMQDEFMC
DVVRCIPRSQVCDHFSHCRDETDEQGCPIEICTEDKWQCDDGYCIDRAKHCDGRVDCPND
HSDEKNGCPQRCPQESTSCRDGDGCFPPEERCNGYSYCRDGTDESGCECRSDEFTCDDRT
CLPGTVKCDGRDDCHYGEDEHNCPGCKINEFQCGSGECISNGFVCDGIKDCVDGSDEHNN
CKEQCHPNDFNCGNGQCVRESRVCDGSKDCDNGFDEKECKNYTCRENEFKCDSGSCIDIN
FRCDGAYQC
Download sequence
Identical sequences A0A0P4VL77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]