SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4VSN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0P4VSN0
Domain Number - Region: 24-99
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00353
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P4VSN0
Sequence length 233
Comment (tr|A0A0P4VSN0|A0A0P4VSN0_9HEMI) Putative lish motif-containing protein {ECO:0000313|EMBL:JAI55478.1} OX=72488 OS=Rhodnius neglectus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
MSYTDKPPEYTKEEWIKKLESMHVQRSDMNKLIMNYLVTEGFKEAAERFQEESGLVPPID
LNSMDNRIQIREAIQNGRIQEATLLVNQLHPELLDNDRYLYFHLQQLHLIELIRDGKVEE
AVHFAQSQLSECGESQPAILNELERTLALLAFDHPLMSPFSDLLDMRHRRKVASEVNTAI
LKTEHHESTHPRLYALVKLILWCQDELAKRNLKFPRMVDLSTTDIVESTPAAK
Download sequence
Identical sequences A0A0P4VSN0 T1HYX0
RPRC009240-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]