SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4W830 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4W830
Domain Number 1 Region: 79-182
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.88e-26
Family PSF3 C-terminal domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 8-72
Classification Level Classification E-value
Superfamily PriA/YqbF domain 3.79e-21
Family PSF3 N-terminal domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P4W830
Sequence length 206
Comment (tr|A0A0P4W830|A0A0P4W830_9EUCA) Uncharacterized protein {ECO:0000313|EMBL:JAI61708.1} OX=85551 OS=Scylla olivacea (orange mud crab). GN= OC=Eubrachyura; Portunoidea; Portunidae; Scylla.
Sequence
MASSRSLHGPSYFPNYYSLEDILATNEKLPCKFEKTVVGMGYLDSSGRSKDLDKGTKLEL
PLWLAAALGPRRKLVTCHLPRAFNERYREILRADATIVDLQGLAPYFYEFGRHLLPLVGA
EGVTLGQLLTETLKQRLRRVMDSSLHCLEDDAAVHKARFDHLERTLFHTGRRMYQDHQLW
LARRCHIITSIASTEQSGKRKLSEIS
Download sequence
Identical sequences A0A0P4W830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]