SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4WV62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4WV62
Domain Number 1 Region: 165-258
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.19e-20
Family Cystatins 0.0067
Further Details:      
 
Domain Number 2 Region: 9-69
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000468
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P4WV62
Sequence length 276
Comment (tr|A0A0P4WV62|A0A0P4WV62_9CRUS) Cystatin {ECO:0000256|RuleBase:RU362130} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MADSNEVVLTYQNSNEVCSLPPVDRTDVACEAYMPMWTFTSATGKCESYVYGGCFRTANL
FRTEEDCLSASGPTANTRTRLIKDAEIQPEAIHLPQDIGVVYIVGRVFMDGDEVSEAISS
HFKRNPNSVLCLGLPCSPGESPTPVDDEVALDIRNTPLAPPPDTPTPVGGFTTVSTNEPD
VQEIAEFATKAMSQVANREYPITLVKIVKAEKQVVAGYNYLLVLELKENPVNDAVFVCDV
TVFDQSWTSTRQITSFQCDPSLSIAPEIQFELAPLS
Download sequence
Identical sequences A0A0P4WV62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]