SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5ES71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5ES71
Domain Number 1 Region: 172-210
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000196
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 2 Region: 133-172
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000667
Family Somatomedin B domain 0.0019
Further Details:      
 
Domain Number 3 Region: 35-75
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000123
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 78-113
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000118
Family Somatomedin B domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P5ES71
Sequence length 214
Comment (tr|A0A0P5ES71|A0A0P5ES71_9CRUS) Uncharacterized protein {ECO:0000313|EMBL:JAJ83056.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
KLFILIAVCGLSSGLLLVEAKLSSFRELKTSKVTDSCIGRCGQSGTDPTQPCQCNPSCQT
TGDCCTDFLSTCSSCASWGRCTEGNNPDWPCQCTEECVNSDNCCPDYAYLCGGVGPTGTT
TIGTTTTGSSGGINSCVGRCGISGTDSTKPCQCNPSCQTYNDCCADFLPTCNTCEGRCTA
GYDSKWPCHCNSQCTSYGNCCPDYSALCFAGFIH
Download sequence
Identical sequences A0A0P5ES71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]