SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5GQX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5GQX8
Domain Number 1 Region: 60-104
Classification Level Classification E-value
Superfamily Neurophysin II 0.00000000000392
Family Neurophysin II 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P5GQX8
Sequence length 169
Comment (tr|A0A0P5GQX8|A0A0P5GQX8_9CRUS) Putative Oxytocin/vasopressin peptide {ECO:0000313|EMBL:JAJ91447.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAALWTLCLIAFSILEMTMPSAAKPCFITNCPPGGKRSGHVSEDPSSFQGVAEERPLLSH
QCASCGPGGKGTCFGASLCCGSEFGCFFKTNETNICLLTNLKSSRSCDERFWQIYFKSAP
CSLNGDKPAVHLDNVNKTSLADWYLVSDQADVTPSISDINCIVNNMIKL
Download sequence
Identical sequences A0A0P5GQX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]