SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5H654 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5H654
Domain Number 1 Region: 343-385
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000209
Family VWC domain 0.037
Further Details:      
 
Domain Number 2 Region: 35-113
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000251
Family Fibronectin type I module 0.074
Further Details:      
 
Domain Number 3 Region: 103-183
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000282
Family VWC domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5H654
Sequence length 797
Comment (tr|A0A0P5H654|A0A0P5H654_9CRUS) BMP-binding endothelial regulator protein {ECO:0000313|EMBL:JAK13295.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTCMCKDGHVQCKKEICPSTGNCYVVLQQNKSAAKCCQVCKGCYYRGVHYQSGSQWNDPD
DPCQTMTCQGGVVTVSRQTCRWNEEDAATADGHCQHLLPARPGECCPRCKGCQWRQARNG
RNVTMAEGGPAASPDPLTEPCTQCQCLPGGSMMCTRQTCPVLPCPANKALLQPGACCPVC
QGVRKEVQPAMAAPAVCQIGKKQFELGAKFRPDPCTNCTCQPNSTTVCLRDNSRRLGGSS
SSSSSCPNVHPATITVAPPLLASWPSDAVASKSATTQPSAMAVVASFQRQQEAAAAASSS
SSSSSSSILSTHGKGSQPQQQQQQQQQQPAMQTPTALPASRPLTCAYRGVTYQDGAGWSL
DPCTQCSCSQGEVRCAVQQCPVYRPKDHHRRKMKSSDSDSSSSSSSSSSSSSSGSGNNVQ
SPLQAANAGQPCPPGRHPVKEAGQCCPKCVEDDAVCTVFGDPHYRTFDGRVFNFQGACKY
LLTSDCRNDTFSVRVTNDARSSRSFSWTKTVTLTIEDLKVTLGQNMKVKVNHKRVSLPFV
SLGVLSVVQEGYSVVVRTNLGVKLLWDGESFLEVTVPPAFKRRLCGLCGNFNGRRRDDLR
MRSGQLATSVEQFGASWKVGGPKSCSSTSTSTSSSAGSSQQQRPPPSSSSSSSADRLSQR
RFQQHHPNQLASSSSTASSSSAAVAGKKTITAAAPDEPLCQRQWHIRIRAVRECSVLKAA
TFAQCHAQVSPVRYFKSCLLDMCECPSGKQCYCEALTAYARECARHGVTQIDPKWREVTS
CTGHHHTGGSTRLHPST
Download sequence
Identical sequences A0A0P5H654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]