SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5HG22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5HG22
Domain Number 1 Region: 193-270
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 4.58e-27
Family USP8 interacting domain 0.0000878
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 79-148
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000144
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5HG22
Sequence length 270
Comment (tr|A0A0P5HG22|A0A0P5HG22_9CRUS) E3 ubiquitin-protein ligase NRDP1 {ECO:0000313|EMBL:JAK23712.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MGIEINRFQGEVDEELLCPICSSVLENPLQAPHCEHAFCSACIHEWLSRQPTCPVDRQNI
TPPQLRPVPRILRNLLYRLQLTCDNSVYGCTAILKLDALESHVQECEFNPKRPVPCELGC
GLVVPKDELKEHNCVRELRSLMQAQQSKLVEVQAEVAESKFQMGEQKRELQLLKDYMLAM
RNANPSLRILADQMEADEVRRWAETLPKARVLRWGGMMIRQLNRRQYENYVCRRIPGKQA
VAVMACDNGHMNPDMILEPGLIMIFAHGVE
Download sequence
Identical sequences A0A0P5HG22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]