SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5KV15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5KV15
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-32
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000951
Further Details:      
 
Domain Number 2 Region: 203-269
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.09e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5KV15
Sequence length 356
Comment (tr|A0A0P5KV15|A0A0P5KV15_9CRUS) Putative Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:JAK71481.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTAAKRPQPENKPSSLLSLEENDQLFKLIGLRCKSMASAVVQVCFADPPSRSQWNLRHCG
VLCFIKDNIKRSYYLRVFCLDRQSVVWEQELYSSFEYCAPRPHFHTFEGDDCRVGLNFAN
DAEAEFFLVAIKENMRIKSEKRERRRLSQQQLQPLVKPTPVATNGSASKTTVRTTTTTNS
VMTKKSKKDKNKKITKADIGLPSDFKHLSHVGWDPNQGFALDNVDPNLLKFFARAGISES
HLKDKATREFIYNFIDKHGAKEAAIREISSLQHNAGLFSAPPDCRVGLNFANDAEAEVFL
MAVKENIRITSEKRERRRLSQQQSQPLVKPTPVATVRTTTITNSVMTIKSADSVLP
Download sequence
Identical sequences A0A0P5KV15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]