SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5NLL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5NLL6
Domain Number 1 Region: 157-204
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000301
Family Thyroglobulin type-1 domain 0.0054
Further Details:      
 
Domain Number 2 Region: 62-162
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000562
Family Thyroglobulin type-1 domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5NLL6
Sequence length 284
Comment (tr|A0A0P5NLL6|A0A0P5NLL6_9CRUS) Thyroglobulin type I repeats domain-containing protein {ECO:0000313|EMBL:JAL11087.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MLLPFVTLGDANCKEGSCDSANCASVDCSFGKMMNDPSSPCGCCKLCIFYIGENEACGVN
MNNRECGPGLTCAVQNPGSEYICVKLETDCFKAQTDYDDRKSSGSLGMYETRPRCDDNGD
FIARKCQPGSSCYCVDVANNRIFGESPPSYATSDVAMNCECSRAYQVAAQQDSLRTVQFP
HCLPNGNYDLLQCVNQACFCIDSANQTLTSSIQPITAIMELPCYKADLHTPNYYRPCELE
RIKAKMLTNSYNRQNITLIGIEQPDCSPDGFYQPLILTKSTYAN
Download sequence
Identical sequences A0A0P5NLL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]