SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5NZS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5NZS1
Domain Number 1 Region: 153-221
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000349
Family VWC domain 0.011
Further Details:      
 
Domain Number 2 Region: 248-315
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000108
Family VWC domain 0.017
Further Details:      
 
Domain Number 3 Region: 39-105
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000174
Family Fibronectin type I module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5NZS1
Sequence length 516
Comment (tr|A0A0P5NZS1|A0A0P5NZS1_9CRUS) Chordin protein 2 {ECO:0000313|EMBL:JAK95055.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTNHRHTCGIMKMLAATWTTVLVLWFPSLITAAELSDGMVCTFTSTNYAVGDVWYPRLGQ
HGTLHCVACVCQEGGKINCTIQNCSGPECTGSESSVENQCCARCSKVGQDAKMPTSITTP
PSPAHSTRVLQENVRVSSFSLSDLSSSSTSSGVTCLHNGNVYRHKERFTSSNVGLKPEHP
DQCVQCSCEGGMVMCQLKDCPKADCEKPVWTKDDCCPACPDPVGRVDEMDNSPVIIQQES
DTINGKMEDCISAGRYYLHGTTWHPVMGPFGPMDCVNCKCKSGRIECQRLECHSRPELSC
ERPIKVAGRCCPVCPFIEGDIQAGPVTPLLPSSPITGTRSNIQENSGIVSSSSNSKIKTP
TRPLLGPSTSSLIRSSTHPGNLTLCLPRDYDVIVYRAQGGGSTSEFIQYMFQQVVNGQGI
EHHMWMLQPTVTTYKVQDLTRDQSEALRQRFRFILLGTTATKHVTRFTKREKKLKPKCLP
NSGCLKKIRRLERNLVLKEVVSRKGCSPLEVEANRR
Download sequence
Identical sequences A0A0P5NZS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]