SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5PC46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5PC46
Domain Number 1 Region: 247-453
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-42
Family Ribonuclease PH domain 1-like 0.0000675
Further Details:      
 
Domain Number 2 Region: 409-515
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.59e-24
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 3 Region: 52-143
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-23
Family Ribonuclease PH domain 2-like 0.004
Further Details:      
 
Domain Number 4 Region: 1-81
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000202
Family Ribonuclease PH domain 1-like 0.0036
Further Details:      
 
Domain Number 5 Region: 507-597
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 134-207
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000102
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 7 Region: 584-666
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000008
Family Cold shock DNA-binding domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5PC46
Sequence length 684
Comment (tr|A0A0P5PC46|A0A0P5PC46_9CRUS) Polyribonucleotide nucleotidyltransferase 1, mitochondrial {ECO:0000313|EMBL:JAL18856.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MIDRSLRPLFPEGYFYETQVVCNLLSVDGVNDPEVLSINAASAALAVSDIPWNGPVAAVR
MGLIDNEVVVNPTRREMAKSQLNLVVSATLQNLVVMLEASAENVYQQDFLKAIKMGVKEC
QIIARTVETLRKEAGKPKREYVTLQSGSEELLSAIKLMSENRLRAILRDFSHDKISRDVA
ISTVRNDVMEKMKAHFPETDTMIISEXXXXXXXXXXXXXXXXXXXXVRNDVMEKMKAHFP
ETDTMIISESFNKFFKELFRKLILDEEIRCDGRKLTDIRKISCDVDLYRPLHGSALFQRG
QTQVVCTVAFDSPESALKSDPVSILMGGLKAKNFFLHYEFPPYATNETGKVGPGSNAGRR
ELGHGALAEKGLRPVVPSDYPFTIRLTSEVLESNGSSSMASVCGGSLALMDAGVPISQPA
AGVAIGLVSRTNPETQQIEDYRILTDLLGIEDYLGDMDFKLAGTKKGITALQADFKLPGV
PLKIIMESVLQASDAKSHILDIMSQTINKPRKDKKDIWPVSEKLQVEAHKRAKFIGLGGA
NLKKLTAEAGVQITAIDESTYSIFAPNQSAMDEAKEMIEQFMKQEREPELEFGAIYKARI
VELKETGVLVTLYPTMVPTLLHNSQLDVRKVAHPSALGLEVGQDISIKYFGRDPVSGRMR
LSRKVLQSPASAIVKNLNGTPSSS
Download sequence
Identical sequences A0A0P5PC46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]