SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5TPU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5TPU9
Domain Number 1 Region: 16-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5TPU9
Sequence length 226
Comment (tr|A0A0P5TPU9|A0A0P5TPU9_9CRUS) Ropporin, rhophilin associated 1B (ROPN1B), mRNA protein {ECO:0000313|EMBL:JAL78266.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MPGLNGAAYQIGNWTNLKPELPGILKEYAKAAIRTDPRDLLQWSRDYFRALSRGSAPLDK
DRWEEVGSLDNHSGITVGLLRLLHKQLSGGRSGQPSDDVNLGDIIQLWTTLGLERQRLDD
LLELVSIETPPLNDGQDLETQENGEPVDNNDGQPNGAKQLRNYDPATVVDWNKLSALAAG
QLGDXXXXXXXXXXXXXXXXXXXXXXXGYRCRLEQTIGAGSRTTWR
Download sequence
Identical sequences A0A0P5TPU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]