SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5VYE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5VYE9
Domain Number 1 Region: 185-272
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 5.89e-30
Family eIF-2-alpha, C-terminal domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 9.16e-30
Family eIF2alpha middle domain-like 0.0000649
Further Details:      
 
Domain Number 3 Region: 11-92
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.15e-19
Family Cold shock DNA-binding domain-like 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P5VYE9
Sequence length 280
Comment (tr|A0A0P5VYE9|A0A0P5VYE9_9CRUS) Eukaryotic translation initiation factor 2 subunit {ECO:0000313|EMBL:JAM09360.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MPLFCRYYGQKYPEVDDVVMVNVRSIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINK
LIRVGKTEPVVVIRVDKEKGYIDLSKRRVSPEDVDKCLEKYSKAKAVNSILRHVAELLKY
QTDEELEELYRKTAWLFEEKSKKQSSSYDVFKQAVNDPSLLDECGLDDNTKEVLLGIIRR
KLTQQAVKIRADIEVACYGYEGIGAVKKALKAGIACSTEEIPIKINLIAPPLYVMTTQTP
ERQDGLKGLEAAIEKVKELIVGLGGVFNIQMAVSLSVQIV
Download sequence
Identical sequences A0A0P5VYE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]