SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5ZG58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5ZG58
Domain Number 1 Region: 45-161
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 5.49e-22
Family Nucleoplasmin-like core domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5ZG58
Sequence length 219
Comment (tr|A0A0P5ZG58|A0A0P5ZG58_9CRUS) Mitotic apparatus protein p62 {ECO:0000313|EMBL:JAM57890.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
GSLISLFKGTATRGLAGVAICTWIDFPHRPHFIFIVQTHFLHIMVEEEYFWGVQLDSKTK
EIEWNPEKNFPKEEKEDGMPIPRHSLMIKQAILSHEAAEGEMAVIEAEAVGYAQSNIKTL
ISVLVQGKDHQRSLDLVFHDAPVKLRLIKGSGPVHLVGAHGVAYRYMGEDDSSDDEDGMG
EEMDDEDDEEEVDVKPPNKKIKKEETPAKGSPSKRGGKK
Download sequence
Identical sequences A0A0P5ZG58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]