SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6C957 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6C957
Domain Number 1 Region: 125-203
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.64e-21
Family tRNA-intron endonuclease catalytic domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 94-123
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0000000192
Family tRNA-intron endonuclease catalytic domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P6C957
Sequence length 240
Comment (tr|A0A0P6C957|A0A0P6C957_9CRUS) tRNA-splicing endonuclease subunit Sen2 {ECO:0000313|EMBL:JAM92471.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
NYYIVGRFNGCSVEIEDVEQKEQLYSYGCFGKGNLSRSLPNFKSSVNDVSETSNLMVEEA
FFLSYVIGCLQVKFQEKFLNLDEIWDLFMKTTNNFLSRYLSYQHFRLSGWVVRSGLKFGG
DFIXXRYLSYQHFRLSGWVVRSGLKFGGDFILYKQGPEFHHASYSVVVRDLNMSNENNNS
WIQLATINRITESVSKELLLCDVVPMHPVPKLTTPECLRHLRLNVVVLKRWVSAQERIID
Download sequence
Identical sequences A0A0P6C957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]