SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6EN38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6EN38
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000547
Family DEATH domain, DD 0.048
Further Details:      
 
Domain Number 2 Region: 26-100
Classification Level Classification E-value
Superfamily DEATH domain 0.0000612
Family DEATH effector domain, DED 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P6EN38
Sequence length 222
Comment (tr|A0A0P6EN38|A0A0P6EN38_9CRUS) Ankyrin-1 {ECO:0000313|EMBL:JAN27310.1} KW=Complete proteome; Reference proteome OX=35525 OS=Daphnia magna. GN=APZ42_032618 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MVSIRDIRNPYSVLIEDVVKLHLAALTEKELKDVVEHFRDQIQSNRVISYIKDIYSLVTV
LEARNVLNSQNVDALLDISKIINRPLAAQRIQDYKKQKELVLHPTLPKIAPPPPLCIESG
QQISREKLIDKVFAEIAKLLGRDVSSFARALPFDLSENELQNLRGQSKGNLEEATLKVLK
LFRERSPNIDHIQSVMQALNIIKRGEIRRKIESILSANAICS
Download sequence
Identical sequences A0A0P6EN38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]