SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6GKQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6GKQ7
Domain Number 1 Region: 9-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 
Domain Number 2 Region: 1352-1380,1420-1450
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000159
Family Motor proteins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P6GKQ7
Sequence length 1577
Comment (tr|A0A0P6GKQ7|A0A0P6GKQ7_9CRUS) Putative Abnormal spindle microcephaly-associated protein/sw {ECO:0000313|EMBL:JAN52338.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MEQTNLLCHRMKIPETLDHLMYCLTKEILCKQPDNVYEFSMKFFHQLVEERDGPNRTPLV
ESTRSKSCKPSSLSIMDAGTGYTDQPNEDGEITDDFEKELQQLNDETLRAEDMSPPPTLD
DSMSDNDTSVTKIAAIVTSKARESPQNAISTPISRTNSDGAMEIPNSPENTEEAIDAFAN
ETFQENALDSNVDALPDSVTEVFDDGQPEVAQSTPEEHVEEHPAEGTPTTPTEETTDDPQ
MPADSNCTEETEHLEPQELVVEEEATENELQENIEDDKPQEIVENELETDGTENDLLHEK
AEEDEQTSAEMVDVVDSSLLQVGEEMAVSLNDELLNSPPLEDTDEKEIIADGIENSEIVT
NHIEESESAAIEPTNLVENIDTPDAANLPIDADSLEETVQLEPSEIVVEGETGEVELQEY
IDEDKPQEIEGNESETTDGVEIDQSNENAEENEQTPADVVDIVDPSMAQEEGETTVNEEV
LNSFSLQDCSEEREAGAENVESQEILANQLDEESDNAADTSTDLPEHSNDEQQHESGHVP
EMNIRLPRSTDFIDMEQDFPVQMDENNHLDIEDIGSSSVVNLEDELSVAQEHYQEATQIE
NSDLGEQIQEENEAIEVGENLGGNDNFIEENENEKLDESEVFAISDVVDEQSSQLENIEE
ILPEVDSEDVPNDNDLHQDASFTEEQSLLSPANENSPFEVENTEQNICEASDDIVLADEN
ADPDNMPEQDDELNAENVTDSESVIKEEPEAETNETTSHVICADTQEDGNLQSELDNEKP
SPDLKENGFSDEDLNELLGEGDKEVSNDDEEEIWSKLQKDLQLEEEEQRNLAAIKIQSTF
RGYQSRKEFNEMLQNKNETEDETDLVTDTVENVPEDQPSIHSPEEESLENNDDDKELTGA
LASVTESIATIALIMTDTPQHDPPLFSTGEEHNDDEPDGNFGSENVVDTIDEFLSNQREV
NDVTEEPMSNGEEIRDIQLIESYVITSSVADNSASPESQEAIINLENSQENGSVSVKDND
DSAKETGDPETEAVASDPGVVFELYVESHETTNDGLLESYCPQREDPPRDVKCIKDNQIN
SDAAELLDKITPRNTNGSIHQNQLDPCLLERENLAATKIQAGYRGHQDRKRVQYLKHHKI
ENVSSTGIDIDKQEELENAAATKIQAGFRGHQDRKRIHNAKCLAAGTGGTVDLQTNFNIV
HEEYQFNHEESIQQIKPDPCLIELQNEAATKIQAGFRGHRDRKRIKDLKGPIVDHNVNGK
NNSSFPQENLVSDDEEYFDETGTSPSTMDLQNAAATKIQAGFRGQQDRKRVKHMQHRIAE
KDVVESDTLQCMDTNYAPERSNEEQSNKNLCLMERENAAATTIQASFRGHQARKRVNNLQ
RPFTGNDGIENGSSQSTDTIYEPDQSNVEQSRQNLCLKELENAAATKIQASFRGYQDRKN
TKHLKKPAKTKDLINNRETNFVDEDCLFDGDEFIQNSKGNPLEKENIAATKIQAGFRGHQ
DRKRVKYLKDSRTRSEIIDSDSACCNEEASLLDYDQSTEAIQVEQQNAAATKIQAGFRGH
QDRKRVKNLKISTDLGE
Download sequence
Identical sequences A0A0P6GKQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]