SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6JW27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6JW27
Domain Number 1 Region: 17-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-54
Family SPRY domain 0.00000000805
Further Details:      
 
Domain Number 2 Region: 221-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000706
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P6JW27
Sequence length 263
Comment (tr|A0A0P6JW27|A0A0P6JW27_HETGA) SPRY domain-containing SOCS box protein 2 {ECO:0000313|EMBL:JAO00197.1} OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=SPSB2 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGQTALAGGGSCTPAPQALCPDLSRPEGLEELLSAPALDLGAQRRHGWNPKDCSENIVVK
EGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPREQRGTHAVVGVATARAPLQADYY
AALLGSNSESWGWDVGRGKLYHQSKGPDAPRYPARPQGEQLAVPERLLVVLDMEEGTLGY
AVGSTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHTLG
DTRLGQVSALPLPPAMKRYLLYQ
Download sequence
Identical sequences A0A0P6JW27
XP_004869516.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]