SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6RT30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6RT30
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 9.68e-19
Family CobE/GbiG C-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P6RT30
Sequence length 125
Comment (tr|A0A0P6RT30|A0A0P6RT30_9RHOB) Precorrin methylase {ECO:0000313|EMBL:KPD12770.1} KW=Complete proteome OX=1225647 OS=Phaeobacter sp. 11ANDIMAR09. GN=AN476_09410 OC=Rhodobacteraceae; Phaeobacter.
Sequence
MKVAGIGFRASATLADLRQALDLLQVQPDALASLRTKAAAEPLITLATERGLPLIALAEE
DIAGEQTLTCSPRIKARFATGSLAEAAALVGARQARPGAGARLIAPRIVTANGLATAALA
ERLDP
Download sequence
Identical sequences A0A0P6RT30
WP_054461064.1.84642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]