SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6VUS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6VUS2
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000241
Family NIPSNAP 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P6VUS2
Sequence length 111
Comment (tr|A0A0P6VUS2|A0A0P6VUS2_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KPL58376.1} KW=Complete proteome; Reference proteome OX=218284 OS=Bacillus vietnamensis. GN=AM506_17320 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIYRRKMYRVSPRIIDDFNLHFNQTLLPTQLKYGSRLVGRWMTTHADGEVEVFAIWEYDS
FEEYERIEANVRGDEAHVKRVQDWYGKWGGRENLKEHFYHIDQDFIDTTVT
Download sequence
Identical sequences A0A0P6VUS2
WP_060673768.1.86773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]